Protein Info for QEN71_RS35995 in Paraburkholderia sabiae LMG 24235

Annotation: ketol-acid reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02826: 2-Hacid_dh_C
  • amino acids 13 to 81 (69 residues), 27.6 bits, E=4.5e-10
• TIGR00465: ketol-acid reductoisomerase
  • amino acids 14 to 325 (312 residues), 433.9 bits, E=1.5e-134
• PF07991: IlvN
  • amino acids 14 to 176 (163 residues), 245 bits, E=7.4e-77
• PF03807: F420_oxidored
  • amino acids 19 to 98 (80 residues), 32.2 bits, E=3.3e-11
• PF03446: NAD_binding_2
  • amino acids 19 to 102 (84 residues), 34.4 bits, E=5.8e-12
• PF01450: IlvC
  • amino acids 182 to 325 (144 residues), 203.5 bits, E=4.6e-64

Best Hits

Swiss-Prot: 82% identical to ILVC_PARXL: Ketol-acid reductoisomerase (NADP(+)) (ilvC) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K00053, ketol-acid reductoisomerase [EC: 1.1.1.86] (inferred from 82% identity to bgl:bglu_1g26060)

MetaCyc: 78% identical to acetohydroxyacid isomeroreductase (Cupriavidus necator H16)
Ketol-acid reductoisomerase. [EC: 1.1.1.86]; 1.1.1.86 [EC: 1.1.1.86]

Predicted SEED Role

"Ketol-acid reductoisomerase (EC 1.1.1.86)" in subsystem Branched-Chain Amino Acid Biosynthesis or Coenzyme A Biosynthesis (EC 1.1.1.86)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-valine biosynthesis (4/4 steps found)
• phosphopantothenate biosynthesis I (4/4 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (8/10 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• phosphopantothenate biosynthesis III (archaea) (2/4 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.86

Use Curated BLAST to search for 1.1.1.86

Protein Sequence (337 amino acids)

>QEN71_RS35995 ketol-acid reductoisomerase (Paraburkholderia sabiae LMG 24235)
MKVFYDKDADLALLKSRSVAIIGYGSQGHAHALNLKDSGINVCVGLRKGPSWEKAKAAGL
TVKSIADAVKEADIVMMLLPDEQIADVYRAEVEPNARKGAVLGFAHGFNIHYGQVNPRAD
LDVMMVAPKAPGHTVRSTYAAGGGVPHLIAVAQDKSGSARDIALAYAAANGGGRAGIIET
SFLEETETDLFGEQAVLCGGLVDLIKAGFEVLVEAGYSAEMAYFECLHEVKLIVDLIYEG
GISNMNYGISNNAEFGEYVTSPRIVTAETKNAMKAVLRDIQTGEYAKSFILENKAGAPTL
QARRRITSSHQIEVVGSKLRAMMPWISKDALVDRSKN