Protein Info for QEN71_RS35970 in Paraburkholderia sabiae LMG 24235

Annotation: sensor domain-containing diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 655 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 88 to 104 (17 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 145 to 171 (27 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 295 to 314 (20 residues), see Phobius details PF05231: MASE1" amino acids 49 to 315 (267 residues), 64.9 bits, see alignment E=2.1e-21 TIGR00229: PAS domain S-box protein" amino acids 328 to 450 (123 residues), 48.1 bits, see alignment E=1.2e-16 PF00989: PAS" amino acids 331 to 419 (89 residues), 34.5 bits, see alignment E=5.6e-12 PF14598: PAS_11" amino acids 343 to 418 (76 residues), 36.4 bits, see alignment E=1.3e-12 PF13426: PAS_9" amino acids 346 to 442 (97 residues), 31 bits, see alignment E=7.9e-11 PF08447: PAS_3" amino acids 354 to 423 (70 residues), 44.8 bits, see alignment E=3.9e-15 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 461 to 625 (165 residues), 150.3 bits, see alignment E=4.2e-48 PF00990: GGDEF" amino acids 464 to 624 (161 residues), 151 bits, see alignment E=7.7e-48

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (655 amino acids)

>QEN71_RS35970 sensor domain-containing diguanylate cyclase (Paraburkholderia sabiae LMG 24235)
MAEAAKKVRATKSFTARMILALVAVRGALSRGESWRLARTGLIGMIAGFVLLVVSGQLKT
MTHEIVAIWITDGCLLGHMMLLRRRYKPVFLTGASIGLLLANMMGDETFYVAFSFTLAGM
VETCAAALMLPGVKSARELIQPKVFIRFVVGACMIAPTLSGIVAVILLQGIFTSHPFSSF
SNWVISDALGFLIFTPVTLVILSGEWRSLREPGNRIESILLLALIGTVSVTVFSQTSYGD
LYWMLPPLALLAFRAELSTVLLGTLLFISIAVPLTIHGTGPLWLSPFASMQERVLALQLF
TVAALSIVLPITVLQTQRNALMNALSEGQRRFKNLAERSEEVVMELSADGRCQYISPRAK
VVLGYEPAALSGTSILDLAHQSDRPELHRALVHTQTTAEEGSVQYRFRRADGTYLWVRSF
IAAMPAGLPGDRSALAFTVRDVDIYVVAEQRRLAEEQRLRDMVFIDSLTGLPNRRYLDTR
VNELLSSHADEAPGRPVAVLFADVDYFKNFNDEYGHQAGDECLRSVGQCIATTVSDRDSV
ARYGGEEFVVLLEDCEHEEALRTAELIRVAVESRALKHRGSPLGVVTLSIGVAQRDICRP
VDAARLFELADSAVYMAKRLGRNRVGEVQDTVSPGAANVSTEWEPTAMPQGATSP