Protein Info for QEN71_RS35710 in Paraburkholderia sabiae LMG 24235

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 23 to 40 (18 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details PF00890: FAD_binding_2" amino acids 22 to 71 (50 residues), 31.4 bits, see alignment 3e-11 PF12831: FAD_oxidored" amino acids 22 to 434 (413 residues), 366.7 bits, see alignment E=5.3e-113 PF01134: GIDA" amino acids 22 to 52 (31 residues), 26.1 bits, see alignment (E = 1.2e-09) PF13450: NAD_binding_8" amino acids 25 to 59 (35 residues), 23.2 bits, see alignment 1.8e-08

Best Hits

KEGG orthology group: None (inferred from 50% identity to pol:Bpro_5110)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>QEN71_RS35710 FAD-dependent oxidoreductase (Paraburkholderia sabiae LMG 24235)
MNQVFSVVEEAARRTPVRYDCDVIVLGAGSAGAAAALAAARQGARVLLIERHGFVGGIMS
ACSLGTICGLYGIDANDEPYSLVGGIPAEVVERLHALGGAAAPKRWVGAVTVPYDLFLLK
VAFDELLREAGVRVALHAQFVAVSSAHGRVEAVFIEDKSGRWAARAPMIIDATGDADVVH
AAGGAFEYDLSTLQLPTTTFRLGGVSEAVARSVGRDQLKEMLEVANERGAGLPRTCGGVY
FQTPGTPHLNLTRITRNGNPPNPLDTFELSDAEFEGRRQVLAYHKAFREFVPGYTDAFVV
DSGIHIGVRESRRVIGDYQLTLSDVQDGRRFEDPIALCSWPVEVHESGTQTRWDWLPPGV
FYQLPWRCLLPRGLANVIVAGRCLSATHDAHGSVRVTATCMAMGQAAGTAAALAAAGQLS
DIRALDYQILRESLVAQGCLLDADPARTAATSCCE