Protein Info for QEN71_RS35675 in Paraburkholderia sabiae LMG 24235

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 85 to 101 (17 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 143 to 169 (27 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 216 to 241 (26 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 340 to 360 (21 residues), see Phobius details amino acids 372 to 391 (20 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 357 (332 residues), 102 bits, see alignment E=1.7e-33

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>QEN71_RS35675 MFS transporter (Paraburkholderia sabiae LMG 24235)
MERAVSKLAEFRRGWSLLLTATVGSAVGLVPIMFYSLGSFIGPLHSEFGWNRGEISMAYL
LATVVLSVAAPGLGVLIDRYGVRKLALLSIPLLAAVLFAISRCERSVLAFQSLYGLAALL
GLGATPVVYTHIVAGAFDKARGLALGIAMSGVAVTTAGLPLLLATIIQAYGWRGGYVTLA
ILVLVAWPFVLHFTRGLKVSAARKQTIMVDTSVFRLPVFWIIGIAFTAVAIAVGAVIVHL
VPMLRDAGLSALAAASVAGFVGIGAIVGRLATGYLVDHLFAPYVAACMFLLTSISFVLLL
FTGTTTAPLAAALTGLSLGVEIDLMAYLTARYFGMLRYGFVYSVIYSMFAIGGAIGPAAA
GRAFDMSGNYRTTLWAAAALRAISAITILRLPRFGRIDQQDSEMLAGPIATGKG