Protein Info for QEN71_RS35405 in Paraburkholderia sabiae LMG 24235

Annotation: carbonic anhydrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00484: Pro_CA
  • amino acids 37 to 187 (151 residues), 155 bits, E=9.8e-50

Best Hits

Swiss-Prot: 47% identical to CAN_EMENI: Carbonic anhydrase (AN1805) from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)

KEGG orthology group: K01673, carbonic anhydrase [EC: 4.2.1.1] (inferred from 90% identity to bph:Bphy_3665)

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

• cyanate degradation (3/3 steps found)
• 3-hydroxypropanoate cycle (10/13 steps found)
• CO₂ fixation into oxaloacetate (anaplerotic) (2/2 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
• superpathway of the 3-hydroxypropanoate cycle (12/18 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• glyoxylate assimilation (8/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (11/18 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (8/14 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (23/56 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.1

Use Curated BLAST to search for 4.2.1.1

Protein Sequence (221 amino acids)

>QEN71_RS35405 carbonic anhydrase (Paraburkholderia sabiae LMG 24235)
MHHPKRLLLSNLAWSQEVSAREPEFFADLARGQQPPILWIGCSDSRVPAERITNAQPGEL
FVHRNIANLYTSDDGNASSVIEYAVHALKVEHVVICGHHHCGGVRAALSPPSDALPVVNR
RIAGLRDLAGHHRDELLAIADFDARVDRLAELNVIEQARLLRESPIIRRAPRPPQVHGWI
FGLREGLLTPLTDMDEAREIAGTHAGSRADMRESIAVRDAA