Protein Info for QEN71_RS35255 in Paraburkholderia sabiae LMG 24235

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13676: TIR_2
  • amino acids 9 to 131 (123 residues), 87 bits, E=1.3e-27
• PF13374: TPR_10
  • amino acids 188 to 217 (30 residues), 15.9 bits, see alignment (E = 8.8e-06)
  • amino acids 230 to 259 (30 residues), 27.6 bits, see alignment (E = 1.9e-09)
  • amino acids 272 to 312 (41 residues), 30.6 bits, 2.1e-10
  • amino acids 313 to 353 (41 residues), 36.4 bits, 3.2e-12
  • amino acids 355 to 395 (41 residues), 44.5 bits, 8.8e-15
  • amino acids 397 to 438 (42 residues), 32.5 bits, 5.5e-11
  • amino acids 439 to 478 (40 residues), 24.7 bits, 1.5e-08
• PF13432: TPR_16
  • amino acids 195 to 262 (68 residues), 20.6 bits, E=4.5e-07
  • amino acids 278 to 344 (67 residues), 24.8 bits, E=2.1e-08
  • amino acids 362 to 428 (67 residues), 15.7 bits, E=1.6e-05
  • amino acids 410 to 467 (58 residues), 20.8 bits, 4e-07
• PF13424: TPR_12
  • amino acids 229 to 302 (74 residues), 64.6 bits, E=6.5e-21
  • amino acids 275 to 345 (71 residues), 65.8 bits, E=2.7e-21
  • amino acids 315 to 385 (71 residues), 73.3 bits, E=1.3e-23
  • amino acids 359 to 430 (72 residues), 74.5 bits, E=5.2e-24
  • amino acids 401 to 468 (68 residues), 64.3 bits, E=8.4e-21
• PF13181: TPR_8
  • amino acids 231 to 263 (33 residues), 17.8 bits, see alignment (E = 2.5e-06)
  • amino acids 319 to 345 (27 residues), 18.4 bits, see alignment (E = 1.6e-06)
  • amino acids 359 to 387 (29 residues), 20.2 bits, see alignment (E = 4.2e-07)
• PF13176: TPR_7
  • amino acids 233 to 264 (32 residues), 21.6 bits, see alignment (E = 1.5e-07)
  • amino acids 275 to 307 (33 residues), 15.7 bits, see alignment (E = 1.1e-05)
  • amino acids 317 to 350 (34 residues), 18.8 bits, see alignment (E = 1.1e-06)
  • amino acids 359 to 389 (31 residues), 23.5 bits, see alignment (E = 3.5e-08)
  • amino acids 442 to 466 (25 residues), 19.6 bits, see alignment (E = 6.4e-07)
• PF17874: TPR_MalT
  • amino acids 318 to 483 (166 residues), 41.3 bits, E=1e-13
• PF14559: TPR_19
  • amino acids 366 to 428 (63 residues), 27.9 bits, E=2.1e-09

Predicted SEED Role

No annotation

Protein Sequence (495 amino acids)

>QEN71_RS35255 tetratricopeptide repeat protein (Paraburkholderia sabiae LMG 24235)
MTDKPTYDVFVSHSSNDRAAASRVARALKDAGVKLWFDEWTLVPGADWTQAIAKALSDVQ
CVIFILGPGKLTSWQQADLNAIEQRRKSDSDVSIVPVLLPGADLNLLPSALSNWQMLDLR
NEDTFESNIRRFADSFKAAKVGKATDVSVYLESLIATLKELDLDTLPTALTSLVGAGNAQ
GEQTEGLASVFNAVGGSLREQGDLARAELLYRKALECDQQTSTPNPQNAANFLNNIASVL
RDQGRLEEALGYLKQALAIDSENRDGDRPNYANRLNNMGSVLLDLGRTREALGYFSQALA
IDMRTLGPDHPDVANRLSNVGSALRDLGELDEARDYFQRSLEIDTQLLGPEHPTVANRLN
NIGSVLRDQGRFDEALSIFEEALAIDQRTFGNEHPRVANRLSNMGSVMAALNRADEAEEL
LNRALAIDEKMLGPNHPDTAITLNNLANLFIRQGKYAEARGTLQRAYNSSCQSVGAAHWL
SQALSANMDSLSGKL