Protein Info for QEN71_RS35165 in Paraburkholderia sabiae LMG 24235

Annotation: MacB family efflux pump subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 693 transmembrane" amino acids 317 to 338 (22 residues), see Phobius details amino acids 566 to 593 (28 residues), see Phobius details amino acids 618 to 647 (30 residues), see Phobius details amino acids 653 to 676 (24 residues), see Phobius details PF00005: ABC_tran" amino acids 25 to 173 (149 residues), 112.5 bits, see alignment E=3.8e-36 PF12704: MacB_PCD" amino acids 317 to 532 (216 residues), 143.1 bits, see alignment E=2.3e-45 PF02687: FtsX" amino acids 572 to 686 (115 residues), 67.5 bits, see alignment E=1.6e-22

Best Hits

Swiss-Prot: 72% identical to MACB_BURCH: Macrolide export ATP-binding/permease protein MacB (macB) from Burkholderia cenocepacia (strain HI2424)

KEGG orthology group: K05685, macrolide transport system ATP-binding/permease protein [EC: 3.6.3.-] (inferred from 72% identity to bcm:Bcenmc03_5332)

Predicted SEED Role

"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (693 amino acids)

>QEN71_RS35165 MacB family efflux pump subunit (Paraburkholderia sabiae LMG 24235)
MTQPLLQLTGVTRRFASGDHETVVLRDINLSIDAGEMVAIMGASGSGKSTLMNILGCLDH
PNAGSYRVAGHETRELDANELAQLRRERFGFIFQRYHLLAHLDAAANVEVPSVYAGSAPQ
ARRRRAIELLARLGLAERAAYRPAQLSGGQQQRVSIARALMNGGDVILADEPTGALDSRC
GHEVIRILRELNALGHTIIIVTHDAQVAAHARRIIEIHDGEIIADRANVPAADDAPERAP
ADGAADNLADDPSVRSAASGALAGEAIRDAAEPADPADPADPAVLLPPARRWSAGFSRFV
EAAGMAWRALVSHRLRTVLTMLGIIIGITSVVSIVAIGEGAKRYMLDEIGSIGTNTISIY
PGADQGDSQADRIQTLVPADVSALAEQPYIDSTTPETSRNLVLRYRNVNVNALVSGVGEF
WFQVRGTRVAQGIGFGPDEVRRQAQVVVIDPNTRQRLFGANVNPLGQVMLVGDLPCIVIG
VTAERKSTFGDAKSLNVWLPYTTASGRLFGQQYLDSITVRVRAGQPSKVAEDGLVKIMTQ
RHGRKDFFTYNMDTVVKTVEKTGRSLTLLLTLIAVISLVVGGIGVMNIMLVSVTERTREI
GIRMAVGARQGDIMQQFLVEAVMVCLMGGAIGVALAFASGVAFSLFIVQWKMVFSMTSVL
AAFLCSTLIGVVFGFMPARNAARLDPIDALARD