Protein Info for QEN71_RS34930 in Paraburkholderia sabiae LMG 24235

Annotation: LysE family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 145 to 169 (25 residues), see Phobius details amino acids 184 to 201 (18 residues), see Phobius details PF01810: LysE" amino acids 16 to 199 (184 residues), 89.3 bits, see alignment E=1.2e-29

Best Hits

KEGG orthology group: None (inferred from 67% identity to bra:BRADO3764)

Predicted SEED Role

"transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>QEN71_RS34930 LysE family transporter (Paraburkholderia sabiae LMG 24235)
MAFHTWLIFLATSIGMSLAPGPNGLLAMTHGAMYGSRKTLFTIGGALLGFVGVIALCMFG
IGALVRASVLWLMALKLIGGAYLIYLGVQVWRSPPIAVEMGNAPARARGWALFRLGLLSS
ATNPKGLLFFSALLPQFIDPQRTLATQFAAIAVTYVATEFVAEYAVACAANRIRPWLSRV
GQRFNRVCGGIFVAIGGLLPLHV