Protein Info for QEN71_RS34560 in Paraburkholderia sabiae LMG 24235

Annotation: type VI secretion system ATPase TssH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 908 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 14 to 866 (853 residues), 1218.2 bits, see alignment E=0 PF00004: AAA" amino acids 232 to 363 (132 residues), 42.7 bits, see alignment E=3.8e-14 amino acids 615 to 699 (85 residues), 29.4 bits, see alignment E=4.9e-10 PF17871: AAA_lid_9" amino acids 374 to 463 (90 residues), 104.7 bits, see alignment E=1.2e-33 PF00158: Sigma54_activat" amino acids 585 to 713 (129 residues), 20.6 bits, see alignment E=1.6e-07 PF07724: AAA_2" amino acids 609 to 776 (168 residues), 175.2 bits, see alignment E=6.1e-55 PF07728: AAA_5" amino acids 614 to 735 (122 residues), 37.9 bits, see alignment E=8.7e-13 PF10431: ClpB_D2-small" amino acids 782 to 852 (71 residues), 50.1 bits, see alignment 1.1e-16

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 84% identity to bpy:Bphyt_0942)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (908 amino acids)

>QEN71_RS34560 type VI secretion system ATPase TssH (Paraburkholderia sabiae LMG 24235)
MTISRQALFGKLGATLFRSIESATTFCKLRGNPYVELVHWLHQLIQLPDSDLHRIVRHAG
IEQDTLERDLARALAALPAGASSISDFSHHIELAIERAWVLATLEFGDRRVRGAWLIAAL
AGTPELRRILLSISPAFGRIPATGMGEALTAWIEGSPESADMPYDNSDFSPAVPGEASQA
VQVAGKGSLLDQYCTDMTARARAGEIDTVTGRGAEIRVMSDILQRRRQNNPLLTGEAGVG
KTAVVEGLALAIAAGDVPPTLAGVRLMSLDVGALLAGASMKGEFESRLKGVLEAAVKSSV
PIILFVDEIHTLVGAGGQAGTGDAANLLKPALARGAVRMIGATTWSEYKRHIEKDPALTR
RFQVLQVPEPEEVAAIDMVRGLAAAFSKHHGVVILDEAIRAAVTLSHRYIPSRQLPDKAI
SLLDTACARVALSQHTPPRELQNVRQRLQAAHVERELLEQEARIGLDADKAMAAVQARIS
TLSAQEGAIDARWQTQLAAARALARARAAVAAGDDDAPSLDTLRNLERMLCDLQGDTPLV
FPDVDAAIIAEIVSDWTGIPVGRMVTDEITAVRTLPETLGARVIGQSDALHQISERVQTA
RAGLADPKKPLGVFLLAGPSGVGKTETALALAEALYGGEQNLITINMSEYQEAHTVSGLK
GAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHHDVHEMFFQVFDKGYMEDGDGRYI
DFRNTTILLTSNAASELTASLCADATLAPDQDGLREALAPELLKTFPAAFMGRVTVVPYR
PLAHASLASIVRLHLNRVVRRMADGHDIALRYSERVVDYIVARCLVQETGARVLIGFIEQ
HILPRLSALWLDAFSSKRALTGIGVDIIDSDAPPSAAIVFEPSGHDVPDVAPAVGADTVT
PVSIGETQ