Protein Info for QEN71_RS34325 in Paraburkholderia sabiae LMG 24235

Annotation: glucose 1-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 12 to 198 (187 residues), 178.8 bits, E=1.3e-56
• PF08659: KR
  • amino acids 15 to 173 (159 residues), 58.6 bits, E=1.2e-19
• PF13561: adh_short_C2
  • amino acids 21 to 257 (237 residues), 202.8 bits, E=1e-63

Best Hits

Swiss-Prot: 37% identical to 3BHD1_EGGLE: 3-beta-hydroxycholanate 3-dehydrogenase (NAD(+)) 1 (Elen_0198) from Eggerthella lenta (strain ATCC 25559 / DSM 2243 / JCM 9979 / NCTC 11813 / VPI 0255)

KEGG orthology group: None (inferred from 90% identity to bur:Bcep18194_B2755)

MetaCyc: 37% identical to NAD-dependent bile acid 3beta-dehydrogenase (Eggerthella lenta DSM 2243)
RXN-11472 [EC: 1.1.1.391]; 1.1.1.391 [EC: 1.1.1.391]; 1.1.1.391 [EC: 1.1.1.391]; 1.1.1.391 [EC: 1.1.1.391]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• palmitate biosynthesis III (28/29 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (23/25 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• biotin biosynthesis I (13/15 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• iso-bile acids biosynthesis I (2/4 steps found)
• bile acids 3-O-epimerization (1/4 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• bile acids epimerization (1/12 steps found)
• mycolate biosynthesis (25/205 steps found)
• superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.391

Protein Sequence (259 amino acids)

>QEN71_RS34325 glucose 1-dehydrogenase (Paraburkholderia sabiae LMG 24235)
MSIKIDGRLAGKVAIVSGGAGGCGAAASELFAAQGAKVAIIDRNGDAAETLASALRDKGL
EAIGIGADVSNQSAVQSAVSAARERFGNTDILFNHAGTLIVKPFLEIEETEWDWLMGVNV
KSMFLMTRAVLPQMLEKGRGSIVCTSSISAVCATPGEVLYDATKGACHMFARAIAVEYRD
RGIRCNAIAPGFIRTPHGIRELKDLQAMGVDATEEAIALQQGRLCEPSEVAAAALFLASD
ESSFVNGTHLFVDNGFSAV