Protein Info for QEN71_RS33995 in Paraburkholderia sabiae LMG 24235

Annotation: malate--CoA ligase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01016: succinate-CoA ligase, beta subunit
  • amino acids 1 to 383 (383 residues), 504.7 bits, E=8.1e-156
• PF08442: ATP-grasp_2
  • amino acids 3 to 203 (201 residues), 233.4 bits, E=2.9e-73
• PF13549: ATP-grasp_5
  • amino acids 4 to 217 (214 residues), 34.1 bits, E=2.7e-12
• PF00549: Ligase_CoA
  • amino acids 263 to 380 (118 residues), 109 bits, E=2.9e-35

Best Hits

Swiss-Prot: 74% identical to MTKA_METEA: Malate--CoA ligase subunit beta (mtkA) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)

KEGG orthology group: K14067, malate-CoA ligase subunit beta [EC: 6.2.1.9] (inferred from 98% identity to bph:Bphy_5927)

MetaCyc: 74% identical to malate thiokinase beta subunit (Methylorubrum extorquens AM1)
Malate--CoA ligase. [EC: 6.2.1.9]

Predicted SEED Role

"Succinyl-CoA ligase [ADP-forming] beta chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• formaldehyde assimilation I (serine pathway) (12/13 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• adipate degradation (5/5 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• pyruvate fermentation to acetate V (3/3 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• TCA cycle III (animals) (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• adipate biosynthesis (4/5 steps found)
• pyruvate fermentation to acetate VI (2/3 steps found)
• methylaspartate cycle (13/19 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• ethylmalonyl-CoA pathway (6/11 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• reductive TCA cycle II (6/12 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (23/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• C5-Branched dibasic acid metabolism
• Citrate cycle (TCA cycle)
• Glyoxylate and dicarboxylate metabolism
• Propanoate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.5, 6.2.1.9

Use Curated BLAST to search for 6.2.1.5 or 6.2.1.9

Protein Sequence (395 amino acids)

>QEN71_RS33995 malate--CoA ligase subunit beta (Paraburkholderia sabiae LMG 24235)
MDIHEYQAKDLLAGFGVPIQRGAVAYTPDQAVYCATELGGWHWAVKAQIHSGARGKAGGI
KLCETYHDVHEAATSLFGKHLVTTQTGPEGKVVERVYVEVAEKFEREIYLGIVLDRKAER
VRVIASAQGGMDIEDIVHTNPDAVHQIVVEPAVGLQPFQAREIAFGLGLNIKQVSRAVST
IMGAYRAFRDLDATMVEINPLVVTTDERVIALDAKISFDDNGLFRHPHVSEMRDAAQEDP
REAEAAQFGLNYVGLDGDIGCIINGAGLAMATMDTIKYAGGEPANFLDVGGGASPERVAA
AFRLVLSDQNVSAVLVNIFAGINRCDWVAEGVVQAARGLRVPLVVRLAGTNVEEGRRIIK
ESGLPIIAADSLLEAAQKAVEASKAHRARQAGNHR