Protein Info for QEN71_RS33810 in Paraburkholderia sabiae LMG 24235

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 314 to 342 (29 residues), see Phobius details amino acids 355 to 378 (24 residues), see Phobius details PF00375: SDF" amino acids 5 to 404 (400 residues), 370.8 bits, see alignment E=4.4e-115

Best Hits

Swiss-Prot: 38% identical to GLTT_BACSU: Proton/sodium-glutamate symport protein (gltT) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 95% identity to bph:Bphy_5637)

Predicted SEED Role

"FIG00464892: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>QEN71_RS33810 dicarboxylate/amino acid:cation symporter (Paraburkholderia sabiae LMG 24235)
MKNRLTLNIAAGMVLGVIAGYVCHTSLSDPATVKAVAGYFSIVTDIFLRLIKMIIAPLVF
ATLVSGLAGMDSGQDVGRIGLRSVGWFVCASLLSLSLGLVLANLLQPGAGLHLVESAAEV
NTGLNTSALNVKDVITHAFPTSLLDAMARNDILQILVFSVFLGLALSALKRDERVKIVVH
AIDGMVPVMLRLTNYVMRAAPLGVFGAIASAVTLRGVDVLYTYGKLIGSFYLGLALLWTI
LIAIGYVFLGRRVGTLLKAVREPAMIAFSTASSEAAYPRLTEQLERFGVDKKVVGFTLPL
GYAFNLDGSMMYQAFAAIFIAQAFGVDMPVSQQIFMLLVLMLSSKGMASVPRGSVVVVAA
VAPMFHLPAAGVAMVLAIDQILDMGRTMTNVIGNSVATAVIAKWEGARQPQSDDAPLFDQ
AEVGAK