Protein Info for QEN71_RS33710 in Paraburkholderia sabiae LMG 24235

Annotation: FAD-dependent monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01494: FAD_binding_3
  • amino acids 6 to 348 (343 residues), 96.1 bits, E=5.3e-31
• PF13450: NAD_binding_8
  • amino acids 10 to 39 (30 residues), 25.4 bits, see alignment (E = 2.7e-09)

Best Hits

KEGG orthology group: K00480, salicylate hydroxylase [EC: 1.14.13.1] (inferred from 91% identity to bge:BC1002_4935)

MetaCyc: 58% identical to salicylate hydroxylase (Pseudomonas stutzeri AN10)
Salicylate 1-monooxygenase. [EC: 1.14.13.1]

Predicted SEED Role

"Putative n-hydroxybenzoate hydroxylase" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

MetaCyc Pathways

• superpathway of salicylate degradation (7/7 steps found)
• methylsalicylate degradation (2/2 steps found)
• salicylate degradation I (1/1 steps found)
• chlorosalicylate degradation (3/7 steps found)
• naphthalene degradation to acetyl-CoA (2/12 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (16/42 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Bile acid biosynthesis
• Fluorene degradation
• Naphthalene and anthracene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.1

Use Curated BLAST to search for 1.14.13.1

Protein Sequence (407 amino acids)

>QEN71_RS33710 FAD-dependent monooxygenase (Paraburkholderia sabiae LMG 24235)
MRKMDLKIAIVGAGIGGLTLALALREHGIDAQLYEQTDELREVGAAVALSANATRFYDRM
GLRSAFEGVCAEVPGLIYRDGRSGEVIGHHRGAPSYREQFGGSYWGIHRADLQAVLSNAV
GLERIKLSHRLVDLVQHDDRVSLSFDNGQQIDADLVIGADGARSITRRWMLGYDDALYSG
CSGFRGVVPAESMDLLPDPETIQFWVGPGGHLLHYPIGDKGDQNFLLVERHPSPWPSRDW
VMPASEGEQLRLFKDWHPAVVQMITAVPISQRWGLFHRPPLGRWSKGRVTLIGDAAHALV
PHHGQGANQSIEDAVVLAAQLGKAGPGPGNWRAAQEAYERLRRGRTRKVQYASISTADVL
HLPDGPAAQARNARLGDRDGVLNHLHWIHGFDALTDEPNERQGGTWL