Protein Info for QEN71_RS33705 in Paraburkholderia sabiae LMG 24235

Annotation: cystathionine gamma-synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 PF01053: Cys_Met_Meta_PP" amino acids 8 to 410 (403 residues), 361.4 bits, see alignment E=4.3e-112 PF00155: Aminotran_1_2" amino acids 69 to 183 (115 residues), 33.3 bits, see alignment E=3.2e-12

Best Hits

KEGG orthology group: K01740, O-acetylhomoserine (thiol)-lyase [EC: 2.5.1.49] (inferred from 93% identity to bge:BC1002_4871)

Predicted SEED Role

"O-acetylhomoserine sulfhydrylase (EC 2.5.1.49)" in subsystem Methionine Biosynthesis (EC 2.5.1.49)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.49

Use Curated BLAST to search for 2.5.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>QEN71_RS33705 cystathionine gamma-synthase family protein (Paraburkholderia sabiae LMG 24235)
MDKQGFTTGIVHGDRITGTEHGGVRQPIHTSVQYGFERVEDLIGVFQGTKKGGFNYARQG
TPTTAALERKITSLEEGAGTVCFSTGMAAITATFLTLLRAGDHIVSSRYVFGNTNSLFGT
LRTLGVEVTTVDACVADNVKNAIQPNTRMVFVETVANPGTQIPDLKGIGDVCRERGIVYV
VDNTITSPALFKPKAVGASLVINSLTKTIAGHGAALGGAVTDTGLFDWSAYPNIADDYRR
SPAKEQGLLQIRKKGLRDMGASLSSEQAHSIAMGAETLALRVKQSSDNALALAQFLEGHK
AVGKVFYPGLKSHPQYDIAQALFKGASWLLSFELLDAQRMIEVVNALKLPIKATGLGDTR
TLIIPVAPTIFFEAGAETRKAMGISDGMLRLSAGIEDIDDLIADFEQALKLAA