Protein Info for QEN71_RS33565 in Paraburkholderia sabiae LMG 24235

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 18 to 35 (18 residues), see Phobius details amino acids 55 to 78 (24 residues), see Phobius details amino acids 92 to 122 (31 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 260 to 284 (25 residues), see Phobius details amino acids 297 to 321 (25 residues), see Phobius details amino acids 334 to 352 (19 residues), see Phobius details amino acids 358 to 380 (23 residues), see Phobius details amino acids 392 to 414 (23 residues), see Phobius details amino acids 420 to 442 (23 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 323 (298 residues), 164.9 bits, see alignment E=2.6e-52 TIGR00893: D-galactonate transporter" amino acids 30 to 442 (413 residues), 472.3 bits, see alignment E=6.5e-146

Best Hits

KEGG orthology group: K03535, MFS transporter, ACS family, glucarate transporter (inferred from 86% identity to bpy:Bphyt_4863)

Predicted SEED Role

"D-glucarate permease" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>QEN71_RS33565 MFS transporter (Paraburkholderia sabiae LMG 24235)
MAISRTANPADAATPTRVRYVILLLIFAITTFNYADRATLSVTGSAMRAEFGFDAIRMGY
IFSAFSWAYVLSQVPAGWLLDRFGARRVYAASIFLWSLFTLLQSSIGVLGSGAAAVTALF
VLRFAMGAAEAPAFPANAKVVASWFPTKERGTASAIFNSAQYFAAVIFTPLMAWLTHAFG
WHHVYIVMGVAGFLLAFTWLKVMKNPAQHPKVNRSELEHIEQGGGLIHGRQTQVAGSLAG
SRSGHARWSIVRQLLGNRMLLGVYLAQFCINVLTYFFLTWFPIYLVQARGMTILKAGLVA
SLPAICGFLGGVLGGILSDAMIRRGHSLTVARKVPIVGGMLLSACIIGCNYVDTDWLVVA
LMSLAFFGKGLGALGWAVVADTSPKEAIGLSGSIFNMFGNMAGIVTPIVIGYLVAQSGSF
NGALAFVGINALVTIFSYLVIVKDIKRVELQQ