Protein Info for QEN71_RS33500 in Paraburkholderia sabiae LMG 24235

Annotation: C4-dicarboxylate transporter DctA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 68 (25 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 145 to 170 (26 residues), see Phobius details amino acids 189 to 212 (24 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details amino acids 265 to 282 (18 residues), see Phobius details amino acids 302 to 328 (27 residues), see Phobius details amino acids 334 to 364 (31 residues), see Phobius details amino acids 388 to 403 (16 residues), see Phobius details PF00375: SDF" amino acids 13 to 405 (393 residues), 376.6 bits, see alignment E=7.2e-117

Best Hits

Swiss-Prot: 58% identical to DCTA3_RALSO: C4-dicarboxylate transport protein 3 (dctA3) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 91% identity to bph:Bphy_6387)

MetaCyc: 56% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"Na+/H+-dicarboxylate symporters" in subsystem Propionyl-CoA to Succinyl-CoA Module

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>QEN71_RS33500 C4-dicarboxylate transporter DctA (Paraburkholderia sabiae LMG 24235)
MLVSKVRKTLSKLYVQVLIGIVAGILVGHFYPDIGSQMKPLGDLFIKLIRMLLAPIIFAS
VVVGIARMNDLHEAGRVGVKAVLYFEVASTIALVVGMLVVNVIKPGSGMNIDPAHIDSAA
ITTYTHAAKQHGMLDFFMSIVPNSIVGAFANGEMLPIIFFSVLLAISLAKLGPRTAPFVD
MLDMFLQGMFGVVRIVMYVAPVGAFGGMAFTIGKYGIGTLASFGELMVCLYLTSIFFVVV
VLGLVMKMCGLSLWKYLRYIRDEILITLGTASTEAVLPQMLIKMEKMGCSRPVVGMVLPT
GYTFNADGTAIYLTMAALFIAQAMNVHLSIWDQLLVLGVLLLTSKGSAGVAGAGFVALAA
TLASMHKIPVEGLVLLLGVDRFLNEARAVTNLIGNGVATLVVARWEGQLDMKQARAVLNR
EIAAEPHAQPAIEPAAEREPAVRSNAH