Protein Info for QEN71_RS33455 in Paraburkholderia sabiae LMG 24235

Annotation: SDR family NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00106: adh_short" amino acids 8 to 198 (191 residues), 188.9 bits, see alignment E=1.1e-59 PF08659: KR" amino acids 10 to 164 (155 residues), 48.3 bits, see alignment E=1.7e-16 PF13561: adh_short_C2" amino acids 14 to 245 (232 residues), 228.4 bits, see alignment E=1.4e-71

Best Hits

KEGG orthology group: None (inferred from 71% identity to bug:BC1001_5506)

Predicted SEED Role

"2-deoxy-D-gluconate 3-dehydrogenase (EC 1.1.1.125)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 1.1.1.125)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.125

Use Curated BLAST to search for 1.1.1.125

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>QEN71_RS33455 SDR family NAD(P)-dependent oxidoreductase (Paraburkholderia sabiae LMG 24235)
MEKRFAGKVVIVTGAGSGIGAATARRFSFEGATVVLCGRTRSKLEGVASTLPAERTLVHP
ADVRKFDEVASLVESTVERFARLDVIVNNAGVAPTGPITEVPIDDWHDVIATDVSGVFYG
CRAAIPHLKATRGAIVNVSSVSGLSGDWGMSFYNAAKGAVSNFTRAAALDCAADGIRVNA
VCPSLTATDLTRDMLDDEKLMKAFRERIPLGDHAQPEDVAAAIAFLASDDARFITGVNLP
VDGGLMASNGQPRQA