Protein Info for QEN71_RS33245 in Paraburkholderia sabiae LMG 24235

Annotation: FAD-binding oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 PF00890: FAD_binding_2" amino acids 16 to 68 (53 residues), 23.1 bits, see alignment 4e-09 PF01266: DAO" amino acids 16 to 360 (345 residues), 216.1 bits, see alignment E=1e-67

Best Hits

KEGG orthology group: K00303, sarcosine oxidase, subunit beta [EC: 1.5.3.1] (inferred from 88% identity to bge:BC1002_5778)

Predicted SEED Role

"Sarcosine oxidase beta subunit (EC 1.5.3.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 1.5.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.3.1

Use Curated BLAST to search for 1.5.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>QEN71_RS33245 FAD-binding oxidoreductase (Paraburkholderia sabiae LMG 24235)
MNDAALSHSGDVREADVLVIGGGLHGSSSAFHMARRGANVIVLEADYVGRHSSGVNAGGV
RTLGRPVPEIPLALMSREIWHTLHDTIGDDGGFVPSGQLKIAETDAELDECRARVALLES
HGFTHEKLIDRASVLELEPALAPHVTGGIWVERDGYALPFRTTTSFRLAAQRHGARFFEG
TPVGRIEQRGTRWFAQTPRGLFSAEKLVITAGAWAGQLADQVGERVPVHPEGLMLMVTHR
VAPFCRATLGATGRPLSFKQFDNGTVVIGGKLIGIADLEARHGEVDFARLVRSANTVVDL
FPHLRHLGVNRAWAGVEAFTDDSLPVISASRRASNLVYSFGYCGSGFQLGPGCGKLVSEL
VLDGKPSLPLDAFAIDRFDEPQAASIRAASAVAH