Protein Info for QEN71_RS33215 in Paraburkholderia sabiae LMG 24235

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 87 to 111 (25 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details amino acids 304 to 325 (22 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details amino acids 365 to 388 (24 residues), see Phobius details amino acids 394 to 415 (22 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 381 (358 residues), 190.5 bits, see alignment E=6.1e-60 PF01306: LacY_symp" amino acids 35 to 199 (165 residues), 25.7 bits, see alignment E=7.7e-10 PF00083: Sugar_tr" amino acids 37 to 192 (156 residues), 43.6 bits, see alignment E=2.9e-15

Best Hits

KEGG orthology group: None (inferred from 91% identity to bph:Bphy_6417)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>QEN71_RS33215 MFS transporter (Paraburkholderia sabiae LMG 24235)
MKRLLPRLLPRLLPKATTMVLATLCLMYFITYVDRVNISTAAGQFKSELGLTNTQLGLIF
SAFAYPYVIFQFIGGWVSDRFGARRTLIACAAVWAVATALTGFAGGFFSLIAARLLLGLG
EGATFPASTSAMAAWVTKDKRGMAQGITHSCARLGNAIAPMLVLALMTAFNWRFSFYLLG
ALSAGWLVLWYFTYTEKPADHARITQAELAVLPPPKVRPADEPGTWMRLYKRMAPVSAVY
FCYNWILWLMLDWMPLYFMHSFHLNIKKAVVFTSGVFIAGVVGDLAGGLVSDKLMRKSGN
VRLARSYLVACCMALTGLSLIPVVLLHDPMYSLIFLAAAMFFNEMNIGPMWAIPMDIAYD
RSGTASGIMSGNGFIAAIVSPVVAGFVVDRLGNWNVTFMLSIGVMICGIVLSFAMKPEVP
FLNSRRAGHARADRDALDASLPLADKR