Protein Info for QEN71_RS32780 in Paraburkholderia sabiae LMG 24235

Annotation: phosphoribulokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 66% identical to KPPR2_CUPNH: Phosphoribulokinase, chromosomal (cfxP) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00855, phosphoribulokinase [EC: 2.7.1.19] (inferred from 98% identity to bph:Bphy_6493)

Predicted SEED Role

"Phosphoribulokinase (EC 2.7.1.19)" in subsystem Calvin-Benson cycle (EC 2.7.1.19)

MetaCyc Pathways

Rubisco shunt (10/10 steps found)
Calvin-Benson-Bassham cycle (11/13 steps found)
1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
ethene biosynthesis V (engineered) (19/25 steps found)
photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
oxygenic photosynthesis (12/17 steps found)

KEGG Metabolic Maps

Carbon fixation in photosynthetic organisms

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.19

Use Curated BLAST to search for 2.7.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>QEN71_RS32780 phosphoribulokinase (Paraburkholderia sabiae LMG 24235)
MSVRHPIVAVTGSSGAGTTTVMRSFAHIFRREKINAQIIEGDAFHRYDRLGMREALRQSE
RDGVRNFSHFGPDANLLDELEQLFAAYGASGGGQFRRYVHDEADAVVYKQDPGTFTPWED
IPVGTDMMFYEGLHGAAVTSKVDIAQHADLLVGVVPIINLEWIQKLHRDQTLRGYSHEAV
VDTILRRMPDYVNYICPQFSRTHVNFQRVPTVDTSNPFTAREIPQPDESFVVIRFSKPKG
IDFPYLLTMLHDSFMSRPNVIVVPGGKMGLAMQLIFTPMILQLRDRQARV