Protein Info for QEN71_RS32705 in Paraburkholderia sabiae LMG 24235

Annotation: formylmethanofuran--tetrahydromethanopterin N-formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01913: FTR
  • amino acids 1 to 150 (150 residues), 200 bits, E=1.7e-63
• TIGR03119: formylmethanofuran--tetrahydromethanopterin N-formyltransferase
  • amino acids 8 to 302 (295 residues), 420.3 bits, E=2.2e-130
• PF02741: FTR_C
  • amino acids 153 to 302 (150 residues), 204.8 bits, E=6.6e-65

Best Hits

Swiss-Prot: 46% identical to FTR_METKA: Formylmethanofuran--tetrahydromethanopterin formyltransferase (ftr) from Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)

KEGG orthology group: K00672, formylmethanofuran--tetrahydromethanopterin N-formyltransferase [EC: 2.3.1.101] (inferred from 94% identity to bph:Bphy_6506)

Predicted SEED Role

"Formylmethanofuran--tetrahydromethanopterin N-formyltransferase (EC 2.3.1.101)" in subsystem Methanogenesis (EC 2.3.1.101)

MetaCyc Pathways

• methyl-coenzyme M oxidation to CO₂ II (4/6 steps found)
• methanogenesis from H₂ and CO₂ (3/6 steps found)
• methyl-coenzyme M oxidation to CO₂ I (3/6 steps found)
• reductive acetyl coenzyme A pathway II (autotrophic methanogens) (3/6 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (11/18 steps found)
• methoxylated aromatic compound degradation II (4/9 steps found)
• superpathway of methanogenesis (5/21 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (23/56 steps found)

KEGG Metabolic Maps

• Folate biosynthesis
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.101

Use Curated BLAST to search for 2.3.1.101

Protein Sequence (314 amino acids)

>QEN71_RS32705 formylmethanofuran--tetrahydromethanopterin N-formyltransferase (Paraburkholderia sabiae LMG 24235)
MQINDTLIDDTFAEAFPMKATRLVITAHTPRWARAAADSLTGFATSVIDCGCEAGIEHEI
SADATPDGRPGISVLMFAVSSKELVKQIARRVGQCVLTCPTTAVYNGIDAATSRAPLSDV
VPLGGSLRFFGDGWQISKMLGGVRYWRVPVMDGEFVCEESVQTVKAVGGGNLLLLARDLD
SALAGAEAAVAAMHRLANVITPFPGGVVRSGSKIGSKYKGAVASTNDAFCPTLTGLSQRS
ELDAQTGCVLEIVIDGLTDADVGAAMTAGIEAASTPGSGVVRISAGNYGGKLGPYHFKLH
ELAASLVQRKTGAP