Protein Info for QEN71_RS32680 in Paraburkholderia sabiae LMG 24235

Annotation: pyrroloquinoline quinone biosynthesis peptide chaperone PqqD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 96 TIGR03859: coenzyme PQQ biosynthesis protein PqqD" amino acids 17 to 96 (80 residues), 105.4 bits, see alignment E=5.5e-35 PF21782: PKMT_2nd" amino acids 17 to 79 (63 residues), 30.5 bits, see alignment E=3.9e-11 PF05402: PqqD" amino acids 34 to 95 (62 residues), 57.5 bits, see alignment E=1.4e-19

Best Hits

Swiss-Prot: 56% identical to PQQD_AZOVD: PqqA binding protein (pqqD) from Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

KEGG orthology group: K06138, pyrroloquinoline quinone biosynthesis protein D (inferred from 90% identity to bph:Bphy_6511)

Predicted SEED Role

"Coenzyme PQQ synthesis protein D" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (96 amino acids)

>QEN71_RS32680 pyrroloquinoline quinone biosynthesis peptide chaperone PqqD (Paraburkholderia sabiae LMG 24235)
MNTPTHDNAQTPEKRGPKLSNLFRLQWEPAQDAHVLLYPEGMVKLNQSAAQILLRCDGTR
DMAALVAELEQTFNAKGLAPEVEAFVDHARSRGWLE