Protein Info for QEN71_RS32645 in Paraburkholderia sabiae LMG 24235

Annotation: heavy metal sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details TIGR01386: heavy metal sensor kinase" amino acids 6 to 452 (447 residues), 401.5 bits, see alignment E=2.8e-124 PF00672: HAMP" amino acids 180 to 232 (53 residues), 27.9 bits, see alignment 3.6e-10 PF00512: HisKA" amino acids 239 to 303 (65 residues), 55.3 bits, see alignment E=8.4e-19 PF02518: HATPase_c" amino acids 351 to 448 (98 residues), 65 bits, see alignment E=1.2e-21

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 93% identity to bph:Bphy_6518)

Predicted SEED Role

"Signal transduction histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (486 amino acids)

>QEN71_RS32645 heavy metal sensor histidine kinase (Paraburkholderia sabiae LMG 24235)
MIRSTRSIARRLALLFALVALSVFTLVDTGLFLVMRSQLEQRLRDSLDSRTEVARIIVHH
AINRDKWRIAQEKLGDMTPRDGTSLYSISSATPLFNYGHTVTGTIVQQWSGDYARVADNG
TGHDLLTRTLIIPPNGERPQVQLQVATSYAPTEQALREFGLALAALSALGAFGASLLSYW
VTRIGLAPLRRLTVDASEVSADNRSQRLRTTELPFELNDLAHSFNGALERLDQAYVRLES
FNADVAHELRTPVTILIGQTQVALTRNRSVDDLRRTLQSNLEEFERMRGIINDMLFLARA
DQGERATELVEVSLATEVARTVEFLEMPMEEAHVQAELHGDAAARVNRSLFGRACANLLI
NAIHHCTPGATIQVTISREAGRVWVAVANPGAPIVGEVLDHVFDRFYRAELSRTNSRENH
GLGLAIVKAVADMHGGVVFARSLDGVNTFGFSIRSDTVRPPKAEPSSAKEPQLASRPIAS
SPLKLP