Protein Info for QEN71_RS32265 in Paraburkholderia sabiae LMG 24235

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 201 to 205 (5 residues), see Phobius details amino acids 300 to 323 (24 residues), see Phobius details PF02743: dCache_1" amino acids 53 to 283 (231 residues), 73.2 bits, see alignment E=2.3e-24 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 336 to 502 (167 residues), 183.6 bits, see alignment E=1.2e-58 PF00990: GGDEF" amino acids 340 to 499 (160 residues), 173 bits, see alignment E=4.5e-55

Best Hits

KEGG orthology group: None (inferred from 65% identity to bcj:BCAL1020)

Predicted SEED Role

"FOG: GGDEF domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>QEN71_RS32265 diguanylate cyclase (Paraburkholderia sabiae LMG 24235)
MVKGDDFRRRRRFGPFRLSLTGPHALFCAGLVIALGMLGICGAILYQARVDALNRARETS
RNLALLAERDIERNFELYDLSMQAVIEGLRDPEVRGSSAHLQRLALFDRAATARYLAAML
VIDASGNIVLDAASDTHRSGNFADRPYFTVHRDNPNVGLYVSDPYQSRLRDGSPSIALSR
RISNPDGSFAGIVVIAVDLNYFQTLLGGLSLGPHGAISLIGRNGIMIMRQPYDAKIIGRD
ISQASTFRNFRAAPEGSFSETSSIDSVRRLYAFRNFPGLPLIVMVAEAEKDIYAAWRARA
IRIGSVMAAFGAAFVVLSVLLGIQQRSRMRAESELRMLARTDGLTGLHNRRTLGEILEHE
WRRARRTRHAFSLLFIDIDCFKAYNDTYGHQAGDETLAAVARCISGSIRRPGDSAARYGG
EEFVVVLPDTDEAGAMSMAESIRRQISDLQIEHGASPYGHVTASVGAASLQADRENEVSA
LVHAADRALYNAKRAGRNRVTLFREAMGAAG