Protein Info for QEN71_RS32145 in Paraburkholderia sabiae LMG 24235

Annotation: 5'/3'-nucleotidase SurE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 79 to 84 (6 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details TIGR00087: 5'/3'-nucleotidase SurE" amino acids 10 to 244 (235 residues), 173.1 bits, see alignment E=3.4e-55 PF01975: SurE" amino acids 11 to 190 (180 residues), 180.7 bits, see alignment E=1.4e-57

Best Hits

Swiss-Prot: 61% identical to SURE1_BURL3: 5'-nucleotidase SurE 1 (surE1) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K03787, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 95% identity to bph:Bphy_6551)

Predicted SEED Role

"5-nucleotidase SurE (EC 3.1.3.5)" in subsystem Folate Biosynthesis (EC 3.1.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>QEN71_RS32145 5'/3'-nucleotidase SurE (Paraburkholderia sabiae LMG 24235)
MSTSSSKVPRVLLTNDDGIDAPGLAVLEAVAAELAEEVWVVAPEHDQSGTSHSISLHSPL
RVSRQGERRFGVVGTPGDCVVMAVRHLMVDAPPTLVLSGINRGGNLGVETMFSGTVGAAM
TGLLLGLPSIALSQTFRDRENVRWDTARALAPGVIRQLLAIEHAAPVCLNVNFPDIDAAA
AGPLTPTKQGVGLVQGIDVLPHVDPRGLEYHWLRFQRGQRENAPDSETAVVASGRVSVTP
LYFDRTDEGTFAKLAASLSNV