Protein Info for QEN71_RS32145 in Paraburkholderia sabiae LMG 24235
Annotation: 5'/3'-nucleotidase SurE
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 61% identical to SURE1_BURL3: 5'-nucleotidase SurE 1 (surE1) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
KEGG orthology group: K03787, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 95% identity to bph:Bphy_6551)Predicted SEED Role
"5-nucleotidase SurE (EC 3.1.3.5)" in subsystem Folate Biosynthesis (EC 3.1.3.5)
MetaCyc Pathways
- purine nucleotides degradation I (plants) (10/12 steps found)
- adenosine nucleotides degradation I (7/8 steps found)
- guanosine nucleotides degradation II (4/4 steps found)
- superpathway of purines degradation in plants (14/18 steps found)
- superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
- adenosine nucleotides degradation II (4/5 steps found)
- guanosine nucleotides degradation I (3/4 steps found)
- guanosine nucleotides degradation III (3/4 steps found)
- inosine 5'-phosphate degradation (3/4 steps found)
- purine nucleotides degradation II (aerobic) (8/11 steps found)
- UTP and CTP dephosphorylation I (5/7 steps found)
- ureide biosynthesis (5/7 steps found)
- NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
- NAD salvage (plants) (6/11 steps found)
- tunicamycin biosynthesis (1/9 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Nicotinate and nicotinamide metabolism
- Purine metabolism
- Pyrimidine metabolism
Isozymes
Compare fitness of predicted isozymes for: 3.1.3.5
Use Curated BLAST to search for 3.1.3.5
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (261 amino acids)
>QEN71_RS32145 5'/3'-nucleotidase SurE (Paraburkholderia sabiae LMG 24235) MSTSSSKVPRVLLTNDDGIDAPGLAVLEAVAAELAEEVWVVAPEHDQSGTSHSISLHSPL RVSRQGERRFGVVGTPGDCVVMAVRHLMVDAPPTLVLSGINRGGNLGVETMFSGTVGAAM TGLLLGLPSIALSQTFRDRENVRWDTARALAPGVIRQLLAIEHAAPVCLNVNFPDIDAAA AGPLTPTKQGVGLVQGIDVLPHVDPRGLEYHWLRFQRGQRENAPDSETAVVASGRVSVTP LYFDRTDEGTFAKLAASLSNV