Protein Info for QEN71_RS31870 in Paraburkholderia sabiae LMG 24235

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 16 to 33 (18 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 86 to 128 (43 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details amino acids 306 to 332 (27 residues), see Phobius details amino acids 344 to 362 (19 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details amino acids 402 to 424 (23 residues), see Phobius details amino acids 430 to 452 (23 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 330 (307 residues), 176.9 bits, see alignment E=5.8e-56 TIGR00893: D-galactonate transporter" amino acids 26 to 452 (427 residues), 483.5 bits, see alignment E=2.4e-149

Best Hits

KEGG orthology group: K03535, MFS transporter, ACS family, glucarate transporter (inferred from 91% identity to bph:Bphy_6596)

Predicted SEED Role

"D-glucarate permease" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>QEN71_RS31870 MFS transporter (Paraburkholderia sabiae LMG 24235)
MANVVQGAAVARRTRIRYGIVAMLFLVTAINYADRATLSMAGTSMSKDLGLDAVAMGFIF
SAFGWSYVIGQLPGGWLLDRFGSKRVYAASIFIWSLFTILQGTVSFLSVSVAITTLFALR
FLVGLAEAPSFPANGRIVASWFPAAERGTASAIFNSAQYFATVLFAPIMGWVTHRFGWPY
VFYFMGVVGVVVSLVWIKTVHSPKDHPRISRAELDHIKEGGALVDMDVPKKQRAALEASA
QAPAQTTATQGANEVPKWSYIKQLLSNRMLLGVYIGQYCITTLTYFFLTWFPVYLVKERG
MSILNAGFVAALPAVCGFIGGVLGGIFSDFLIRKGCSLTVARKVPIVVGMLLSTSMIACN
YVDSSAVVVAIMAFAFFGKGLGALGWAVVADTSPKQIAGLSGGMFNTFGNIAAITTPIII
GYIVKATGSFSGALVFVACNALIAIVSYLVIVGEIKRVELK