Protein Info for QEN71_RS31775 in Paraburkholderia sabiae LMG 24235

Annotation: bacteriohopanetetrol glucosamine biosynthesis glycosyltransferase HpnI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 6 to 36 (31 residues), see Phobius details amino acids 292 to 326 (35 residues), see Phobius details amino acids 341 to 365 (25 residues), see Phobius details TIGR03472: hopanoid biosynthesis associated glycosyl transferase protein HpnI" amino acids 10 to 379 (370 residues), 450.6 bits, see alignment E=1.8e-139 PF13641: Glyco_tranf_2_3" amino acids 47 to 277 (231 residues), 73 bits, see alignment E=5.1e-24 PF13506: Glyco_transf_21" amino acids 103 to 277 (175 residues), 137 bits, see alignment E=7.4e-44 PF13632: Glyco_trans_2_3" amino acids 137 to 325 (189 residues), 46.5 bits, see alignment E=6.2e-16

Best Hits

KEGG orthology group: K00720, ceramide glucosyltransferase [EC: 2.4.1.80] (inferred from 85% identity to bph:Bphy_7079)

Predicted SEED Role

"Ceramide glucosyltransferase (EC 2.4.1.80)" (EC 2.4.1.80)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.80

Use Curated BLAST to search for 2.4.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>QEN71_RS31775 bacteriohopanetetrol glucosamine biosynthesis glycosyltransferase HpnI (Paraburkholderia sabiae LMG 24235)
MSFDEARLVLTCFFGLCAAFGVVYTIIATVLVGPFFARRSPACERYPPVTVIKPLSGMEA
TLLSNLRSFCEQDYPGTVQYLFGVHDAGDPALDVVRELQVLYPAVHITTIVNSALHGCNR
KVSNLINMLPSAEYDVFVFADSDVTVAGDYLSRVVGELETEGVGLVTCAYVGVPDPGFWP
QLSARAVDYQFLPGVVAGLRAGLAQPCFGQTIVMRRETLDAIGGLGQFAGLLAEDHAIGV
AVRATGQKVVVPGFVVGHACPESTAVRLMEHELRWSRTIRRIDPIGHAGSALSYPVAWAA
LALMTGGAPVWAVLQFVIALAARALLQSRIDALLKRPVRSLWLLPLWDLLAFAILCLSFS
SSRIVWRGVSFRVDGRGMLTVEPGRSSADRAS