Protein Info for QEN71_RS31095 in Paraburkholderia sabiae LMG 24235

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 transmembrane" amino acids 86 to 109 (24 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 13 to 167 (155 residues), 74.4 bits, see alignment E=3e-24 PF13579: Glyco_trans_4_4" amino acids 19 to 164 (146 residues), 55.9 bits, see alignment E=1.6e-18 PF20706: GT4-conflict" amino acids 125 to 293 (169 residues), 39.1 bits, see alignment E=1.1e-13 PF00534: Glycos_transf_1" amino acids 186 to 334 (149 residues), 72.6 bits, see alignment E=7.6e-24 PF13692: Glyco_trans_1_4" amino acids 186 to 326 (141 residues), 71.4 bits, see alignment E=2.5e-23

Best Hits

KEGG orthology group: None (inferred from 87% identity to bph:Bphy_6702)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>QEN71_RS31095 glycosyltransferase family 4 protein (Paraburkholderia sabiae LMG 24235)
MRILQVVYAPRLSGAEILAKGLAIQHREGGHEVCITSMQPQLADFDHSRGELAAAGVLCD
FPDSPLGRVGRLRHLWRCVRRFRPDIIIAHATLAALYIRLLPSVAPVVYVMHSGSNDFAN
PKLKWAERMLSHRAKAVVGVSPQNTRDYLREVGPHPYVTVIPNGVDLPRFEPAVPAPELD
TSIAAPQIVQLGRYVVDKGQLETIQAFEIVLQHEPDARLVVYGVIEDRAYHDMAMNLVHR
LNLAERVTLCGPSSNVAAILQTSRVFAMPSHMEAHSIGFLEALASGIPVVASRIAAFEFA
RDFPGVSLVDTKNPAMYARALLDALNAPRARRVLDGYTLRDTAERYLKIAQTVFHGDGIA
ENASLHDWKSNESSM