Protein Info for QEN71_RS31065 in Paraburkholderia sabiae LMG 24235

Annotation: 2-methylcitrate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 TIGR01800: 2-methylcitrate synthase/citrate synthase II" amino acids 21 to 388 (368 residues), 506 bits, see alignment E=2.5e-156 PF00285: Citrate_synt" amino acids 22 to 371 (350 residues), 406.9 bits, see alignment E=3.8e-126

Best Hits

Swiss-Prot: 86% identical to PRPC_CUPNE: 2-methylcitrate synthase (prpC) from Cupriavidus necator

KEGG orthology group: K01659, 2-methylcitrate synthase [EC: 2.3.3.5] (inferred from 97% identity to bph:Bphy_6707)

MetaCyc: 87% identical to 2-methylcitrate synthase (Cupriavidus necator)
2-methylcitrate synthase. [EC: 2.3.3.5]

Predicted SEED Role

"2-methylcitrate synthase (EC 2.3.3.5)" in subsystem Methylcitrate cycle or Propionate-CoA to Succinate Module (EC 2.3.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.3.5

Use Curated BLAST to search for 2.3.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (389 amino acids)

>QEN71_RS31065 2-methylcitrate synthase (Paraburkholderia sabiae LMG 24235)
MSEADNGATNAGAFKPKKSVALSGVTAGNTALCTVGKTGNDLHYRGYDILDIAGACEFEE
VAHLLVHGKLPNVAELAAYKTKLKALRGLPANVKAALEWIPAAAHPMDVMRTGVSVLGTV
LPEKDDHNLPGARDIADKLMASLGSMLLYWYHYSHNGKRIEVETDDDSIGGHFLHLLHGV
EPSKSWVDAMHVSLNLYAEHEFNASTFTGRVIAGTGSDMYSAITGAIGALRGPKHGGANE
VAFEIQSRYQTPDEAEADIRRRVENKEVVIGFGHPVYTISDPRNKVIKDVAKKLSKEQSN
MKLFDIAERLESVMGDVKKMFPNLDWFSAVSYHMMGVPTAMFTPLFVISRTSGWAAHIIE
QRVDNKIIRPSANYTGPDNLAFVPLAKRA