Protein Info for QEN71_RS31015 in Paraburkholderia sabiae LMG 24235

Annotation: ureidoglycolate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 73% identical to UGL_BURM1: Ureidoglycolate lyase (Bmul_3283) from Burkholderia multivorans (strain ATCC 17616 / 249)

KEGG orthology group: None (inferred from 93% identity to bph:Bphy_6717)

MetaCyc: 82% identical to 5-hydroxy-2,4-dioxopentanoate hydrolase (Herbaspirillum huttiense)
RXN-12096 [EC: 3.7.1.26]; 3.7.1.26 [EC: 3.7.1.26]

Predicted SEED Role

"2,4-diketo-3-deoxy-L-fuconate hydrolase" in subsystem L-fucose utilization temp

MetaCyc Pathways

L-rhamnose degradation III (6/7 steps found)
L-arabinose degradation V (5/6 steps found)
D-arabinose degradation IV (4/6 steps found)
D-xylose degradation VI (3/5 steps found)
L-fucose degradation III (5/8 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>QEN71_RS31015 ureidoglycolate lyase (Paraburkholderia sabiae LMG 24235)
MKLLRYGAPGHEKPGILDGSGAIRDLSGVIDDIAGLTLLPEALEKLRGLDVNALPIVSAE
ERIGACVGRIGKFICIGLNYADHAAESNLPVPAEPVVFGKWTSAVVGPNDDVRIPRGSQK
TDWEVELGVVIGKGGTYIEEADALSHVAGYCVINDVSEREYQIERGGTWDKGKGCDTFGP
IGPWLVTADEIPDPQRLALWLEVDGKRYQNGNTSTMIFNVAHIVSYLSRFMSLQPGDVIS
TGTPPGVGMGQKPEPVYLRAGQTMRLGIEGLGEQQQRTVAA