Protein Info for QEN71_RS30760 in Paraburkholderia sabiae LMG 24235

Annotation: sulfate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 117 to 142 (26 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 189 to 215 (27 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details amino acids 268 to 288 (21 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 369 to 388 (20 residues), see Phobius details amino acids 400 to 431 (32 residues), see Phobius details TIGR00815: sulfate permease" amino acids 25 to 567 (543 residues), 382.9 bits, see alignment E=1.2e-118 PF00916: Sulfate_transp" amino acids 40 to 404 (365 residues), 294 bits, see alignment E=1.5e-91 PF01740: STAS" amino acids 457 to 567 (111 residues), 61.3 bits, see alignment E=6.8e-21

Best Hits

KEGG orthology group: None (inferred from 87% identity to bph:Bphy_5012)

Predicted SEED Role

"putative solute transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (575 amino acids)

>QEN71_RS30760 sulfate permease (Paraburkholderia sabiae LMG 24235)
MQSDRPIHEGGQAAVSAPRWLRWLPGLTMLRTYRGSYLPNDLTAGLVLTTMLVPVGIAYA
EASGVPGVYGLYATIVPLLAYAVFGPSRILVLGPDSALAAPILAVVIAIAGSDPSRAIAT
ASMMAIVSGLFCIVMGLLRLGFITELLSKPIRYGYMNGIALTVLISQLPKLFAISFDDRG
PLRDLLSLVAAIAAGKANWYSFAVGAGSLVLILLLKRFEKVPGILIAVVLATLSVIAFDL
DGVGVKVLGKIPQGLPSFALPWIGDIDFVRILLGGCAVALISFADTSVLSRTFAARSHTR
VDPNQEMVGLGAANLAAGFFQGFPISSSSSRTPVAEAAGARTQMTGVVGALAVAVLLLAA
PNLMRYLPNSALAAVVIAAALGLFEFADLRRIYRIQQWEFWLSVVCFAGVAVFGAIPGIC
IAIVIAVIEFLWDGWRPHYAILGRVEDLRGYHDIKRYPQATRIPGLLLFRWDAPLFFANA
ELFQECLLRAVDESSTAVRRIVVAAEPVTSIDVTSADMLRELIRILGERDIALHFAEMKD
PVRDKLRRFEMLEIVGDQRFHPTVGSAVDDYVGEH