Protein Info for QEN71_RS30585 in Paraburkholderia sabiae LMG 24235

Annotation: class I poly(R)-hydroxyalkanoic acid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 TIGR01838: poly(R)-hydroxyalkanoic acid synthase, class I" amino acids 39 to 565 (527 residues), 717.9 bits, see alignment E=3.4e-220 PF07167: PhaC_N" amino acids 82 to 248 (167 residues), 221.1 bits, see alignment E=8.4e-70 PF00561: Abhydrolase_1" amino acids 248 to 489 (242 residues), 71.7 bits, see alignment E=7.7e-24

Best Hits

Swiss-Prot: 55% identical to PHAC_CUPNH: Poly(3-hydroxyalkanoate) polymerase subunit PhaC (phaC) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K03821, polyhydroxyalkanoate synthase [EC: 2.3.1.-] (inferred from 88% identity to bph:Bphy_6754)

MetaCyc: 55% identical to poly-beta-hydroxybutyrate polymerase subunit (Cupriavidus necator)
RXN1-42 [EC: 2.3.1.304]

Predicted SEED Role

"Polyhydroxyalkanoic acid synthase" in subsystem Polyhydroxybutyrate metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.304

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (568 amino acids)

>QEN71_RS30585 class I poly(R)-hydroxyalkanoic acid synthase (Paraburkholderia sabiae LMG 24235)
MKMPFSMPDEFASGWVKAGFNFWRALPLSNEAGNETGNTRKTLTQASADYWRQQTALFTS
VLTSTAGGKFASQPVVQPEQGDRRFHAEDWSNNGWYSLLKQHYLITARMLEDMVEASTLD
EKEKHKLRFYTRQFIDLASPTNYAATNPEVIRHALESNGSSLVSGATRLLEDMKDGCISI
TDRSAFEVGRSVAASEGSVVFENELFQLIQYAPLTPTVARRPLVIVPPCINKFYILDLQP
DNSFVRFACEQGLTVFLVSWRNPDETMSDTQWDAYLESGVMKALEVARTITRADKVNALG
WCVGGTMLSSALAVMRAKGDDTVASATLLTALLDFSEPGDLGVFIDETGVSMREHTIGRG
GLYPGRELGFVFQTLRANDLIWPYVVNNYLKGKTPAAFDLLYWNADTTNLPGPMYSWYLR
NMYLENSLRVPNRLRMCGTPVDLGRIDMPAYLLATEEDHIVPWRSAYQSTQLLGGDTEFV
LGASGHIAGVINPASRNKRSYWTGGTPDSDAEQWLTGATRQAGSWWNHWIRWVKQHAGDE
VKARTTPGSAKYKPIEPAPGRYVKVRAD