Protein Info for QEN71_RS30010 in Paraburkholderia sabiae LMG 24235

Annotation: FAD-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 589 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details PF00890: FAD_binding_2" amino acids 14 to 552 (539 residues), 281.2 bits, see alignment E=3.6e-87 PF12831: FAD_oxidored" amino acids 14 to 61 (48 residues), 32.7 bits, see alignment 1.1e-11 PF13450: NAD_binding_8" amino acids 17 to 53 (37 residues), 22.1 bits, see alignment 3e-08

Best Hits

KEGG orthology group: None (inferred from 84% identity to bph:Bphy_6094)

Predicted SEED Role

"fumarate reductase/succinate dehydrogenase flavoprotein, N-terminal:FAD dependent oxidoreductase" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (589 amino acids)

>QEN71_RS30010 FAD-binding protein (Paraburkholderia sabiae LMG 24235)
MQAKQESRWDEEVDLLIFGAGAAGMTAALIAHHEGLNVLVCEKTDAVGGITSTSGGTTWV
PGTQLSVDAGVPDSIDDARRFLQSVVGDRGGDEAREAFLQSGPLAIDELQRISDVRFVAA
AAHPDYVTGPGAAFGGRALAPVPFDARVLGADFARVRPPRKEFMGLGGMMVNRSDLNSLL
FPFASVGNFKRTLAVVGRYFVDRLRFSRGTQLVMGNALAARLFYSLRKRGVDVRFDAPLV
ELVRENGKVTGAVVGSKNGATKRIGARRGVVLATGGVTRHPTLRKQLFPVGAQPLSLSPE
THTGDGVGSALKLDARLENGGDSPGLWMPCSIRRSGNGDDHVWPHIILDRAKPGLIAVNR
RGERFVNESNSYHDFVMGMLRDEDQGTSVPAHLIVDAAFIRDYGLGLLMPGRSRARIAEF
ERAGYLVKGATLAELAKKLDVDAAGLARTVETYNRHAASGEDPAFGRGSSPMSRFNGDAA
QKPNPCIRPLGDGPYYAVTVWPADLACSAGLAGTANGEVLDAHGAVIPGLFACGNDLASI
FRGTYPGPGTTLGPAIVFGWRIAKFVAGKEVGNSAVRQTRPQACLHDTP