Protein Info for QEN71_RS29855 in Paraburkholderia sabiae LMG 24235

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 43 to 378 (336 residues), 216.7 bits, see alignment E=2e-68 PF16576: HlyD_D23" amino acids 58 to 290 (233 residues), 46.1 bits, see alignment E=7.4e-16 PF13533: Biotin_lipoyl_2" amino acids 68 to 115 (48 residues), 51.5 bits, see alignment 1.4e-17 PF13437: HlyD_3" amino acids 179 to 280 (102 residues), 25.9 bits, see alignment E=2.7e-09

Best Hits

Swiss-Prot: 42% identical to MDTA_PANAA: Multidrug resistance protein MdtA (mdtA) from Pantoea ananatis (strain AJ13355)

KEGG orthology group: None (inferred from 91% identity to bph:Bphy_3489)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>QEN71_RS29855 efflux RND transporter periplasmic adaptor subunit (Paraburkholderia sabiae LMG 24235)
MKFNRSSRRVLLVAGVAAVGVIVWQAYAAFHKPAHPPAQETPVTIGTVKRADVPLQLDAL
GTVTPRATVTVKTQVNGTLEAVLVKEGQRVKAGQPIARIDSRALRAQLLEAQGTLEHDEA
LLANAQADLKRYETLIDGGSISRQTLDTQRATLRQYQGTVKADQGSVANLQVQVGYCDIV
APMDGTIGLLSTDAGNYVTTSDTTGIATITSDSPTTVVYALPEDRMGDVVDAFHDKGALP
VEIFARDKRTVLDHATLAAIDNQADTTTGTVKLKASAPNAGGKLFPNRFVNVRMTVGTLN
DALTVPTVAIQHGASGDFVLTLASTDVTKGAGKVALRRVTAGVAYNDATVIAQGNLKAGD
AIVLDGADKLDDGSAVKIVRN