Protein Info for QEN71_RS29825 in Paraburkholderia sabiae LMG 24235

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 transmembrane" amino acids 25 to 50 (26 residues), see Phobius details amino acids 58 to 83 (26 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 170 to 175 (6 residues), see Phobius details amino acids 193 to 216 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 25 to 115 (91 residues), 51.9 bits, see alignment E=4.4e-18 PF00528: BPD_transp_1" amino acids 50 to 219 (170 residues), 55.4 bits, see alignment E=3.3e-19

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 87% identity to bph:Bphy_7229)

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>QEN71_RS29825 amino acid ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MSEIDWLPTLRYLLLGTFPNGPLGGAGLTLVMSVASALLSAVLGLAGGVALSMTRGAVHL
ALIAIVGFFRAIPVLMLIFWTFFLMPMLLHIDVPGLATVVCALALIGGAYLSHSVHAGIA
AVGAGQEQAAASLGLTRWQALRYVLLPQAVRIMTPSFVNQWVSLIKDTSLAYIVGVPEFT
FLANQINNRLMVYPVQIFLFVGLVYLLLCSALQFVATRLLESGRRRDTSGAQSRITRFSH
VQSADS