Protein Info for QEN71_RS29820 in Paraburkholderia sabiae LMG 24235

Annotation: sulfite dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details TIGR04555: sulfite dehydrogenase" amino acids 30 to 425 (396 residues), 584.2 bits, see alignment E=7.2e-180 PF00174: Oxidored_molyb" amino acids 109 to 275 (167 residues), 160 bits, see alignment E=4.2e-51 PF03404: Mo-co_dimer" amino acids 296 to 409 (114 residues), 61.1 bits, see alignment E=1.2e-20

Best Hits

KEGG orthology group: None (inferred from 93% identity to bph:Bphy_7230)

Predicted SEED Role

"Sulfur oxidation molybdopterin C protein" in subsystem Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>QEN71_RS29820 sulfite dehydrogenase (Paraburkholderia sabiae LMG 24235)
MSNPPIPDPKTAPASPRRRMLGGLALSALVAPNVKAATLLRPLSVDPWTQTPGAPILDHP
YGQPSPREANVVRRAARAWPMPGAASSLTPLADLHGTITPNGLVYERHHAGVPDIDPDEH
RLAVHGLVREPKLFTMDDLVRLPSESRIHFLECSGNTASEWKGPSGLPVQITHGLLSCCE
WTGVRLSTLLEATGGLAASSDGRAPKWLLAEGADASSMTRSLPLERILDRALVVYAQNGE
RLRPENGYPLRLIVPGFEGNTNVKWLRRLKLVDAPLETREETSKYTGLLPDGRARQFVFE
MDAKSVITRPSAGHRLTVQGFYPIVGLAWSGRGAIRRVEVSTDGGTTWQDATLDEPARDR
ALTRFHSGWVWNGEPTVILSRATDSTGYVQPTREALVQARGLNSNYHYNGIHQWRVGADG
SVKNA