Protein Info for QEN71_RS29800 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 45 to 67 (23 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 206 to 229 (24 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 115 to 285 (171 residues), 78.7 bits, see alignment E=2.3e-26

Best Hits

Swiss-Prot: 34% identical to SSUC_BACSU: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 89% identity to bph:Bphy_7234)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>QEN71_RS29800 ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MSLTRSLSPSRLFAPRKASGPPPCSCDASFESPRTSSFRKRLAAFNWRGLVLPLAAFALW
WLVSALHVAKSGLLVSPVDVAHTAWQQIQSGALLRALSASLAREASGFLIGTVSGLLLGA
ALGFSRIATRLIGPTFDTFKQISLFAWIPLISVWFGLGDMAKVVFLSLAALLPVAAHTCD
GIHAVPPRYVEVARAFRYSRLQMARFVILPAALPSIFTGIYLALIYSWLATLGAEYLLVA
GSGIGNTLIDGSEQFRMDLVLFGIIVVGITGWALNAFARGIERRVFARRTRSSHESAAA