Protein Info for QEN71_RS29795 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 38 to 60 (23 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 102 to 277 (176 residues), 98.3 bits, see alignment E=2.3e-32

Best Hits

Swiss-Prot: 37% identical to SSUC_BACSU: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Bacillus subtilis (strain 168)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 89% identity to bph:Bphy_7235)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>QEN71_RS29795 ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MSKAIDQWQPLSKRATQNTASEASETARRRVRAVAWHLAPWLLPAVLFTLWSVGCARGWI
APQILPPPQQVFDTLRELATSGDLAHHTLVSLQRVLVGFGVGTLAGLLIGAALGLSRTVE
ACVLPAFNALVQIPVLGWLPFLLLLVGVGEPLKYILIAHAALVPVTLSTMQGVRNTPAPL
DEAARVFGYSRWQRVAYVVLPAAVPTLATGVRLAFTKAWLALVVVELVASSEGLGYLIVY
GRQLFQLDLVMASVVIVGAIGFAINRLLDALEARLRRGQPSAFRE