Protein Info for QEN71_RS29775 in Paraburkholderia sabiae LMG 24235

Annotation: phosphate signaling complex protein PhoU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02135: phosphate transport system regulatory protein PhoU
  • amino acids 8 to 220 (213 residues), 216.4 bits, E=1.7e-68
• PF01895: PhoU
  • amino acids 22 to 108 (87 residues), 69.5 bits, E=1.3e-23
  • amino acids 128 to 211 (84 residues), 69.5 bits, E=1.4e-23

Best Hits

Swiss-Prot: 50% identical to PHOU_BURSP: Phosphate-specific transport system accessory protein PhoU homolog (phoU) from Burkholderia sp.

KEGG orthology group: None (inferred from 94% identity to bph:Bphy_7239)

Predicted SEED Role

"Phosphate transport system regulatory protein PhoU" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Protein Sequence (235 amino acids)

>QEN71_RS29775 phosphate signaling complex protein PhoU (Paraburkholderia sabiae LMG 24235)
MSDKHLSSQFDAALNMLSTHLLAMGGMVERQITRCLTLIDDYDPALVQEIRDSERELNAL
EIEIDEEIHRVIARRQPAARDLRLLMAMSKCVTNLERMGDEARKISKRLRRIDESGSSST
IPLTELRSSGEMAASVLHRVLDAFARMDAVAAAQIVRDDKAIDEAFRAFVRRLVAQMSET
PQTVSVALEYLFIAKALERIGDHAKNIAEFVVFVVKGRDVRHIPLGELEREALTS