Protein Info for QEN71_RS29630 in Paraburkholderia sabiae LMG 24235

Annotation: LysE family translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 61 to 88 (28 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details amino acids 148 to 172 (25 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details PF01810: LysE" amino acids 15 to 199 (185 residues), 118 bits, see alignment E=2e-38

Best Hits

KEGG orthology group: None (inferred from 96% identity to bph:Bphy_3092)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>QEN71_RS29630 LysE family translocator (Paraburkholderia sabiae LMG 24235)
MTLAHWLPFAIASAILVAIPGPTVLLVISYALGHGRRYALVTTAGVALGDLTSMTASMLG
LGVILAASATLFTALKWVGAAYLIYLGIKLWRAPVSAGEAPAVGETRTSRIFAHAYAVTA
LNPKSIVFFVAFVPQFIDTQVATWSQIAVFEATFVALGTLNALGYAVLASAARRAIRSPR
VQRSVNCTGGTLLIGAGLLAVAWKKSAA