Protein Info for QEN71_RS29430 in Paraburkholderia sabiae LMG 24235

Annotation: 4a-hydroxytetrahydrobiopterin dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01329: Pterin_4a
  • amino acids 3 to 94 (92 residues), 119.8 bits, E=2.3e-39

Best Hits

Swiss-Prot: 83% identical to PHS_PARXL: Putative pterin-4-alpha-carbinolamine dehydratase (Bxeno_A4379) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K01724, 4a-hydroxytetrahydrobiopterin dehydratase [EC: 4.2.1.96] (inferred from 83% identity to bxe:Bxe_A0010)

MetaCyc: 60% identical to Pterin-4-alpha-carbinolamine dehydratase (Homo sapiens)
4a-hydroxytetrahydrobiopterin dehydratase. [EC: 4.2.1.96]

Predicted SEED Role

"Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96)" in subsystem Pterin biosynthesis (EC 4.2.1.96)

MetaCyc Pathways

• L-phenylalanine degradation V (2/3 steps found)
• tetrahydropteridine recycling (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.96

Use Curated BLAST to search for 4.2.1.96

Protein Sequence (98 amino acids)

>QEN71_RS29430 4a-hydroxytetrahydrobiopterin dehydratase (Paraburkholderia sabiae LMG 24235)
MIQKLTSEERTQQVAQLNGWQNVEGRDAIKRQFKFADFNEAFGFMTRVAIKAQEMDHHPE
WFNVYSNVEITLSTHDANGITERDIRLARFIDEITAGK