Protein Info for QEN71_RS29375 in Paraburkholderia sabiae LMG 24235

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 49 (19 residues), see Phobius details amino acids 55 to 72 (18 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details amino acids 235 to 263 (29 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 29 to 273 (245 residues), 104.6 bits, see alignment E=2.6e-34

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 97% identity to bph:Bphy_3045)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>QEN71_RS29375 branched-chain amino acid ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MQRKALYVLLLLALIAAPFVGAYPVFVMKVLCFALFAAAFNLLIGYTGLLSFGHAMFLAT
AGYVTGYAIQTLTLSPELGVVAGTVAATLLGLVVGLFAIRRQGIYFAMVTLALAQMVYFV
FLQAPFTHGEDGLQGVPRGKLFGVLSLSSDLTLYFVVLAVMVLAFLLIVRIVHSPFGQVL
IAIKESEPRAISLGYDTNRFKLLAFILSAGLAGLAGSLKVLVLGFETLGDAYWTMSGLVV
LMTLVGGMGTLFGPLLGAALIVALEDRLGDIGGGLASMTGVEWFRSLGESATIVTGLIFI
ACVLAFRRGIVGEIVQRVKPLRA