Protein Info for QEN71_RS29325 in Paraburkholderia sabiae LMG 24235

Annotation: sodium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 93 to 122 (30 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 167 to 194 (28 residues), see Phobius details amino acids 215 to 248 (34 residues), see Phobius details amino acids 259 to 281 (23 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 325 to 348 (24 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details PF03600: CitMHS" amino acids 29 to 317 (289 residues), 113.7 bits, see alignment E=1e-36 PF00939: Na_sulph_symp" amino acids 54 to 192 (139 residues), 28.3 bits, see alignment E=9.7e-11

Best Hits

KEGG orthology group: None (inferred from 92% identity to bph:Bphy_3035)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>QEN71_RS29325 sodium:proton antiporter (Paraburkholderia sabiae LMG 24235)
MPAAERTLKPNRNLLRTITHYVAKEPVLTVLVAALIALQVFHPRPFTSLPALVDWQTVMT
LAGLLILTKAVEYSGFLMWLAHRVVHRIRSQRALAYLLIGLAAALSTLLTNDVALFVVVP
LALSLNELTPLPLKRLVIFIAIAVNAGSILTPLGNPQNLFLWQTSGVSFGGFVVALAPLC
LVLMVMLYVLAAVSFKRIELDLSKDTEPHPVDRPLLGVAAILFAAFVLLADAHRAGIGLI
GVALGFIFWRPRIVLKIDWLLLLIFVFMFIVLRSVAALPWVHDAIGQLHLATPLRAYAAG
AVLSQVISNVPAAIMLAEFSKDWRALAFGVSVGGFGFAIGSLANLIAMRLSGERGMWTQF
HLFSVPFWVVGGVIGGWLLLHF