Protein Info for QEN71_RS29255 in Paraburkholderia sabiae LMG 24235

Annotation: putative sulfate exporter family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 33 to 58 (26 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 219 to 242 (24 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 334 to 351 (18 residues), see Phobius details amino acids 373 to 393 (21 residues), see Phobius details amino acids 406 to 428 (23 residues), see Phobius details amino acids 441 to 464 (24 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 116 to 443 (328 residues), 146.2 bits, see alignment E=5.5e-47

Best Hits

KEGG orthology group: None (inferred from 96% identity to bph:Bphy_3021)

Predicted SEED Role

"Inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>QEN71_RS29255 putative sulfate exporter family transporter (Paraburkholderia sabiae LMG 24235)
MSDTRHTLPAGAQPSRQASTTGGGGLFSTEDWWAVWVGLLVIVVAWGLFASGSSIKWLAT
APAKWSDLGAAGQDLAKHLPNYVALFVVFAVLFGVSLSVLKQRIAHFLPSFAILFVASVL
IFEVGAWANASKYNLEPPLVALALGLLISNVFTLPEWFSAGLRVEFYIKVGIVLLGATLP
FTLLVWAGPVAVGQATIVSLVTFFVIFFAAKALGLDKRFAAVLGVGGAVCGVSASIAIAG
AVRAKREHASVAITLVILWAIVMIFVLPFVSRSLGLSTAVAGAWIGTSEFADAAGIAAAQ
AYGDFAKHAGGAIAGSPEASLQAFTLMKVVGRDIWIGIWAFLLAIVATTRWESGENGVAA
KADAREIWARFPKFVIGFVIASALVTWIASHYSLADYRKVVTPEFVAPITALRTWAFIFC
FFSIGLTTRVRSLAATGIKPFIAFTIGVAVNIAIGYALSAHVFAPYWNNLGQGS