Protein Info for QEN71_RS29190 in Paraburkholderia sabiae LMG 24235

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF01408: GFO_IDH_MocA" amino acids 5 to 119 (115 residues), 90.4 bits, see alignment E=2.9e-29 PF03447: NAD_binding_3" amino acids 29 to 115 (87 residues), 24.4 bits, see alignment E=8.4e-09 PF22725: GFO_IDH_MocA_C3" amino acids 130 to 247 (118 residues), 102.8 bits, see alignment E=2.7e-33 PF02894: GFO_IDH_MocA_C" amino acids 134 to 342 (209 residues), 106.4 bits, see alignment E=3.8e-34

Best Hits

Swiss-Prot: 46% identical to YDGJ_ECOLI: Uncharacterized oxidoreductase YdgJ (ydgJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to bph:Bphy_3001)

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>QEN71_RS29190 oxidoreductase (Paraburkholderia sabiae LMG 24235)
MSSSLKIGLMGYGFAGATFHAPVIAHCGRASVAAIATGQPDKARADYPDAKIVADIDALL
ALPEIECVVIATPNDTHFDLARRTLEAGKHVVVDKPVTLSAADARTLADLAQSKGLLFAP
FHNRRWDGDFMTVRDLLASGELGRLTHFESHFDRFRPGIRQRWREEASRGGGLLFDLGPH
LIDQALTLFGVPETVYATVKAYRDNASAPDYVHLLLGYANHEVVLHASALTAIVAPRYTI
HGTRGSYVKYGLDTQEDQLKAGLRPGDAGFGGGNEAGTLRVLEGEQEVQRELPTRDGAYA
DFYRALAASIQDGAPFPINAQDAVDVMAIIELADRSEKEGVRLQFKRGA