Protein Info for QEN71_RS29105 in Paraburkholderia sabiae LMG 24235

Annotation: glycosyltransferase family 41 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07721: TPR_4
  • amino acids 7 to 27 (21 residues), 12.4 bits, see alignment (E = 0.0002)
  • amino acids 211 to 231 (21 residues), 13.6 bits, see alignment (E = 8.2e-05)
  • amino acids 241 to 263 (23 residues), 12.4 bits, see alignment (E = 0.0002)
• PF13432: TPR_16
  • amino acids 9 to 70 (62 residues), 23.3 bits, 6.5e-08
  • amino acids 75 to 137 (63 residues), 27.4 bits, 3.5e-09
  • amino acids 143 to 205 (63 residues), 34.1 bits, 2.6e-11
  • amino acids 177 to 240 (64 residues), 43.1 bits, 4e-14
  • amino acids 212 to 270 (59 residues), 25.9 bits, 9.9e-09
  • amino acids 339 to 400 (62 residues), 27.6 bits, 2.9e-09
• PF07719: TPR_2
  • amino acids 71 to 102 (32 residues), 24.6 bits, see alignment (E = 1.7e-08)
  • amino acids 172 to 204 (33 residues), 33.6 bits, see alignment (E = 2.2e-11)
  • amino acids 242 to 270 (29 residues), 23.3 bits, see alignment (E = 4.4e-08)
• PF13181: TPR_8
  • amino acids 72 to 102 (31 residues), 16.8 bits, see alignment (E = 5.4e-06)
  • amino acids 104 to 135 (32 residues), 13.6 bits, see alignment (E = 5.9e-05)
  • amino acids 138 to 168 (31 residues), 25 bits, see alignment (E = 1.3e-08)
  • amino acids 172 to 204 (33 residues), 24.1 bits, see alignment (E = 2.4e-08)
  • amino acids 209 to 238 (30 residues), 14.9 bits, see alignment (E = 2.1e-05)
  • amino acids 242 to 271 (30 residues), 20.4 bits, see alignment (E = 3.9e-07)
  • amino acids 333 to 363 (31 residues), 17.9 bits, see alignment (E = 2.4e-06)
  • amino acids 368 to 399 (32 residues), 22.1 bits, see alignment (E = 1.1e-07)
• PF13414: TPR_11
  • amino acids 77 to 114 (38 residues), 40.2 bits, 2e-13
  • amino acids 145 to 186 (42 residues), 38.7 bits, 5.8e-13
  • amino acids 179 to 217 (39 residues), 46 bits, 3e-15
  • amino acids 314 to 345 (32 residues), 35.5 bits, see alignment (E = 5.9e-12)
• PF13431: TPR_17
  • amino acids 128 to 157 (30 residues), 22.6 bits, see alignment (E = 8e-08)
  • amino acids 160 to 193 (34 residues), 24 bits, see alignment (E = 3e-08)
• PF00515: TPR_1
  • amino acids 138 to 170 (33 residues), 27.9 bits, see alignment (E = 1.3e-09)
  • amino acids 172 to 204 (33 residues), 41.7 bits, see alignment (E = 6e-14)
• PF13374: TPR_10
  • amino acids 138 to 169 (32 residues), 21.3 bits, see alignment (E = 1.9e-07)
  • amino acids 176 to 200 (25 residues), 19.4 bits, see alignment (E = 8e-07)
  • amino acids 244 to 274 (31 residues), 25.6 bits, see alignment (E = 8.8e-09)
  • amino acids 337 to 362 (26 residues), 17.4 bits, see alignment (E = 3.4e-06)
• PF14559: TPR_19
  • amino acids 152 to 210 (59 residues), 25.3 bits, 1.4e-08
  • amino acids 182 to 230 (49 residues), 30.1 bits, 4.6e-10
• PF13424: TPR_12
  • amino acids 172 to 237 (66 residues), 35.1 bits, E=1.1e-11
• PF13176: TPR_7
  • amino acids 174 to 205 (32 residues), 24.1 bits, see alignment (E = 2.3e-08)
• PF13174: TPR_6
  • amino acids 178 to 204 (27 residues), 12.8 bits, see alignment (E = 0.00014)
• PF13844: Glyco_transf_41
  • amino acids 438 to 598 (161 residues), 90.9 bits, E=5.4e-29
  • amino acids 620 to 796 (177 residues), 56.1 bits, E=2e-18

Best Hits

KEGG orthology group: None (inferred from 87% identity to bph:Bphy_2992)

Predicted SEED Role

"TPR domain protein, putative component of TonB system" in subsystem Ton and Tol transport systems

Protein Sequence (813 amino acids)

>QEN71_RS29105 glycosyltransferase family 41 protein (Paraburkholderia sabiae LMG 24235)
MDHANLLNTALAHHQAGRLAEAKAIYDEILRANPRHSDALHFLGLLACQIQQYDAGITLM
RQSIAILPNAIYHNNLGNALREHGQLKQSIDSYREAVTLNPGYAEAHNNLGNALREDRQP
DAAMHSCAHAIELRPGYAEAYNNLGNALKDLGETDSAVLAYRKAISFRQHYADAHNNLGN
ALTEQGKYDEAIASYHSAIALDPNRALIHNSLGTLYLARGELAEAAASLRRSVELDPERP
GVHNNLANTLRDMGDLEAARAHYAKALQLAQAVVDAYQTGGGATSLAHLRFPKPQLTLAE
AFATLGNAWYGLYRYEEAIESYLRAVALTDDDAEVHHNLAVAYLKTERANEALRYARKAL
ELKDGSSRMHINLGDVLRSLGELEAAVNSYRSAIERSPDADVAHTALLFCEASMSQRPVE
EFLADAIYFGKRMAANVTPFAHTRAPRGTRPLRVGFVSGDLRTHPVGIFTESVLRHVDPS
RIELIAYQTNDVEDETTQRLKPLFGEWTQLWKLSREAAAQRIFDDRIDILLDMSGHTAFN
RLSVFAMKPAPVQVTWLGFFASTGIAQMDYVLGDRYVLPPEEAHHFIEKPWHLPDGYLCM
TPPEHDVSVGPLPMQANGFVTFGYLGKLAKMTDEVLDLWVRVLREVPDSRLLIKAHELDR
KHAVDATLQRFAERGIDASQLILEGGSKRGEYFKTYHRVDIVLSPFPYPGGTTTAESLWM
GVPVVAMKGDRFLGHICESVLHSAGFGEWICDDQASYVQKVRELASSVESLAKLRAGLRE
HVLASPMCDAHRFARNFEDALEGMWSAYEESGN