Protein Info for QEN71_RS28910 in Paraburkholderia sabiae LMG 24235

Annotation: flagellar hook assembly protein FlgD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF03963: FlgD" amino acids 23 to 90 (68 residues), 79.9 bits, see alignment E=1.9e-26 PF13861: FLgD_tudor" amino acids 98 to 232 (135 residues), 40.8 bits, see alignment E=3.1e-14 PF13860: FlgD_ig" amino acids 116 to 192 (77 residues), 75.5 bits, see alignment E=4.1e-25

Best Hits

Swiss-Prot: 36% identical to FLGD_SALTY: Basal-body rod modification protein FlgD (flgD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02389, flagellar basal-body rod modification protein FlgD (inferred from 91% identity to bph:Bphy_2950)

Predicted SEED Role

"Flagellar basal-body rod modification protein FlgD" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>QEN71_RS28910 flagellar hook assembly protein FlgD (Paraburkholderia sabiae LMG 24235)
MTTSTTIGNNGASVSQTLLDTMNGTNSASSSSSSSATSGSDLQNTFLQLLIAQMKNQDPT
SPMDSSQMTSQLAQINTVTGIGQLNTSLTSLASQLTTSQQTQAANLISSTVLAPGNGFSV
ASGKATGFGVTLASDATDVQVTVKNSAGQIVNTIDLGKQSAGTIPIGWTPVDKSGNALPD
GNYTFTASSTTANGTGAPATLSAATVQGIIKQPDGSPGLVLSNGKTVGLTSVAAII