Protein Info for QEN71_RS28905 in Paraburkholderia sabiae LMG 24235

Annotation: flagellar hook protein FlgE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 TIGR03506: flagellar hook-basal body protein" amino acids 2 to 239 (238 residues), 139 bits, see alignment E=1.6e-44 amino acids 253 to 485 (233 residues), 170.8 bits, see alignment E=3.4e-54 PF00460: Flg_bb_rod" amino acids 6 to 33 (28 residues), 35.1 bits, see alignment (E = 1.5e-12) PF07559: FlaE" amino acids 265 to 384 (120 residues), 82.3 bits, see alignment E=7.2e-27 PF06429: Flg_bbr_C" amino acids 425 to 502 (78 residues), 63.6 bits, see alignment E=2.1e-21

Best Hits

KEGG orthology group: K02390, flagellar hook protein FlgE (inferred from 95% identity to bph:Bphy_2951)

Predicted SEED Role

"Flagellar hook protein FlgE" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (502 amino acids)

>QEN71_RS28905 flagellar hook protein FlgE (Paraburkholderia sabiae LMG 24235)
MGYQQGLSGLAGASSDLDVIGNNIANANTVGFKQGAAQFADMYANSVATAVNNQIGIGTR
MSEVEQNFSQGTISTDDIALHVAINGNGFFQMSNNGSLTYSRNGVFQLDKNGYIVNADGL
KLMGYAANANGIINTAGTVPLQVPTANIPPTATKTITAGLNLNAQDALKLGTPAVTFGAT
NTGSLTNNGVSITDATQGTNANTYTVSFTSPTAYTITGSDGSSTSGTYSANSPIKLGNGE
TITLAGTPATGDSVTVAPTSLAFDPTNSATYSYSTSVPVYDSLGGEQQVDMYFVKTSAGS
WDVYAGKDGSVPTTKVGTAKFDTSGNLVSTLDNAGNPTSTLFAFNFSIPNSDGSATPQSL
TLKIGGTTQFGSKDGTNSLTQDGFAAGQLTNFTVGTDGTITGNYSNGQTAALGQVALATF
ANQNGLINLGNNEFQATAASGVAVVAAPGSTNHGSLQGGATENSNVDLTSELVNLITAQR
NYQANAQTIKTQQAVDQTLINL