Protein Info for QEN71_RS28880 in Paraburkholderia sabiae LMG 24235

Annotation: flagellar assembly peptidoglycan hydrolase FlgJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02541: flagellar rod assembly protein/muramidase FlgJ
  • amino acids 18 to 309 (292 residues), 344.5 bits, E=3.9e-107
• PF10135: Rod-binding
  • amino acids 56 to 102 (47 residues), 59.5 bits, 3.7e-20
• PF01832: Glucosaminidase
  • amino acids 173 to 309 (137 residues), 129.6 bits, E=1.1e-41

Best Hits

KEGG orthology group: K02395, flagellar protein FlgJ (inferred from 97% identity to bph:Bphy_2956)

Predicted SEED Role

"Flagellar protein FlgJ [peptidoglycan hydrolase] (EC 3.2.1.-)" in subsystem Flagellum (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Protein Sequence (310 amino acids)

>QEN71_RS28880 flagellar assembly peptidoglycan hydrolase FlgJ (Paraburkholderia sabiae LMG 24235)
MNSDTTRNAANDLTNRFALDTQGFDAMRAQAAANPREAMKSAAKQFDAVFTQMMLKSMRD
ATPQDGPFDSHDSATFTSMMDQQLSQQMSSKGIGVADAMLKQLMRNSGMSADDSNAGNNV
ALNALAKAYANPANNGALKMGRGYTANSALTPPVRGDGSSDKVDAFVDKLAAPAQAASAA
TGIPARFIIGQAALESGWGKREIKKSDGSTSHNIFGIKATDDWNGKTVATVTTEYVHGRP
QRVVEKFRAYDSYEEAMTDYASFLKSNPRYAQVINSSRDVNGFAQGMQRAGYATDPHYAK
KLISIMQKMV