Protein Info for QEN71_RS28810 in Paraburkholderia sabiae LMG 24235

Annotation: flagellar protein export ATPase FliI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 TIGR01026: ATPase, FliI/YscN family" amino acids 105 to 546 (442 residues), 594.8 bits, see alignment E=9.5e-183 TIGR03496: flagellar protein export ATPase FliI" amino acids 120 to 544 (425 residues), 654.9 bits, see alignment E=4.7e-201 PF00006: ATP-synt_ab" amino acids 255 to 466 (212 residues), 296.4 bits, see alignment E=1.2e-92 PF18269: T3SS_ATPase_C" amino acids 474 to 543 (70 residues), 86.8 bits, see alignment E=7.2e-29

Best Hits

KEGG orthology group: K02412, flagellum-specific ATP synthase [EC: 3.6.3.14] (inferred from 97% identity to bph:Bphy_2934)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (547 amino acids)

>QEN71_RS28810 flagellar protein export ATPase FliI (Paraburkholderia sabiae LMG 24235)
MVKPTIEDIQHSDLTPLERELALASFGAEALTVAQMEESLAALESAISDAHAGADAKSSD
EPKASAPHPEAAPASRELAPAPKRTPDPALLDNPHLQAWRNRLTGLRERNQIARPLRACG
RLTRAAGLVLEAVGLRLAVGSEVMIELPPGSTRTMAEAEVVGFHGDKLFLMPTTEVAGLL
PGARVYPLEVAPIADPMAGAKRLPVGWELLGRVVDASGKPLDGFGPLNSRNDAPLTAPTI
NPLHREPIHKVLDVGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGTMARYTSAEVIVIG
LIGERGREVKEFIEQILGEEGLARSVVVAAPADVSPLLRMQGAAYATSLAEYFRDQGKHV
LLLMDSLTRYAMAQREIALAIGEPPATKGYPPSVFAKLPALVERTGNGPEGGGSITAFYT
VLTEGDDQQDPIADSARAILDGHIVLSRALAEAGHYPAIDIEASISRAMTALINDAHLDR
TRQFKQMLSRYQRNRDLINVGAYSAGRDAVLDKAIALYPRMEAFLQQGFRESAGFDASVA
HLDSLFG